WH0079039M1

Monoclonal Anti-DDX54 antibody produced in mouse

clone 2H6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, Anti-DP97, Anti-MGC2835
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); IF; IHC (p); WB
• clone: 2H6, monoclonal
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2H6, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_024072
• nº de adesão UniProt: Q8TDD1
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... DDX54(79039)

Descrição

Descrição geral

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. (provided by RefSeq)

Imunogênio

DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)