Todas as fotos(2)

Documentos Principais

WH0057348M4

Monoclonal Anti-TTYH1 antibody produced in mouse

Name: Monoclonal Anti-TTYH1 antibody produced in mouse
Brand: SIGMA

clone 4A9, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-tweety homolog 1 (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato

Todas as fotos(2)

About This Item

Código UNSPSC:

12352203

NACRES:

NA.41

Produtos recomendados

Slide 1 of 1

1 of 1

BAB609011000

SP Bel-Art^® Durac^® Calibrated Thermocouple Thermometer

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

4A9, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

NM_020659

nº de adesão UniProt

Q9H313

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TTYH1(57348)

Categorias relacionadas

Primary Antibodies

Descrição geral

This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Imunogênio

TTYH1 (NP_065710, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN

Ações bioquímicas/fisiológicas

The gene TTYH1 (tweety homolog 1) encodes a protein that functions as a chloride channel. It may be involved in early embryonic development. It is suggested to function in cell process formation and cell adhesion. Its expression in brain is found to be increased during epileptogenesis and epilepsy, indicating its involvement in brain pathology.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Expression of Ttyh1, a member of the Tweety family in neurons in vitro and in vivo and its potential role in brain pathology.

Marzena Stefaniuk et al.

Journal of neurochemistry, 115(5), 1183-1194 (2010-09-30)

We have previously shown that Ttyh1 mRNA is expressed in neurons and its expression is up-regulated in the brain during epileptogenesis and epilepsy. In this study, we aimed to elucidate the role of Ttyh1 in neurons. We found widespread expression

Ttyh1 protein is expressed in glia in vitro and shows elevated expression in activated astrocytes following status epilepticus.

Elzbieta Wiernasz et al.

Neurochemical research, 39(12), 2516-2526 (2014-10-16)

In a previous study, we showed that Ttyh1 protein is expressed in neurons in vitro and in vivo in the form of punctuate structures, which are localized to neuropil and neuronal somata. Herein, we provide the first description of Ttyh1

Expression of Ttyh1, a member of the Tweety family in neurons in vitro and in vivo and its potential role in brain pathology.

Stefaniuk M

Journal of Neurochemistry, 115, 1183-1194 (2010)

Cloning and Functional Analysis of Rat Tweety-Homolog 1 Gene Promoter.

Malgorzata Gorniak-Walas et al.

Neurochemical research, 46(9), 2463-2472 (2021-06-27)

Tweety-homolog 1 protein (Ttyh1) is abundantly expressed in neurons in the healthy brain, and its expression is induced under pathological conditions. In hippocampal neurons in vitro, Ttyh1 was implicated in the regulation of primary neuron morphology. However, the mechanisms that

Long-term survival in a case of ETANTR with histological features of neuronal maturation after therapy.

Antonelli M

Virchows Archiv, 466, 603-607 (2015)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica