WH0055062M2

Monoclonal Anti-WIPI1 antibody produced in mouse

clone 3C1, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-Atg18, Anti-FLJ10055, Anti-WD repeat domain, phosphoinositide interacting 1, Anti-WIPI49
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); WB
• clone: 3C1, monoclonal
• reatividade de espécies: rat, human, mouse
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3C1, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: rat, human, mouse
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão GenBank: NM_017983
• nº de adesão UniProt: Q5MNZ9
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... WIPI1(55062)

Descrição

Descrição geral

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM

Imunogênio

WIPI1 (NP_060453.2, 348 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)