WH0008805M1

Monoclonal Anti-TRIM24 antibody produced in mouse

clone 2F2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-PTC6, Anti-RNF82, Anti-TF1A, Anti-TIF1, Anti-TIF1A, Anti-TIF1ALPHA, Anti-hTIF1, Anti-tripartite motif-containing 24
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2F2, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG3κ
• nº de adesão GenBank: BC028689
• nº de adesão UniProt: O15164
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TRIM24(8805)

Descrição

Descrição geral

Tripartite motif-containing 24 (TRIM24) is a co-regulator that belongs to the transcription intermediary factor 1 family. It is also known as transcription intermediary factor 1α (TIF1α). TRIM24 has an amino-terminal RING-B boxes-coiled coil (RBCC/TRIM) motif, a carboxy-terminal plant homeodomain (PHD) finger-bromodomain unit and a nuclear receptor interaction box (NR box or LXXLL motif). This gene is located on human chromosome 7q33-q34.

Imunogênio

TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW

Ações bioquímicas/fisiológicas

Tripartite motif-containing 24 (TRIM24) acts as a potential prognostic biomarker for ESCC (esophageal squamous cell cancer). This protein induces the development of tumor and generates chemotherapy resistance through the phosphatidylinositide 3-kinase (PI3K)/Akt pathway. TRIM24 modulates p53 protein levels by changing the stability of p53.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)