WH0007267M9

Monoclonal Anti-TTC3 antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-DCRR1, Anti-DKFZp686M0150, Anti-RNF105, Anti-TPRDIII, Anti-tetratricopeptide repeat domain 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2D10, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_003316
• nº de adesão UniProt: P53804
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TTC3(7267)

Descrição

Descrição geral

TTCR (tetratricopeptide repeat protein 3) is one of the main genes present within the Down syndrome critical region (DSCR) on human chromosome 21q22.2. The encoded protein is an E3 ubiquitin liase, composed of 2025 amino acids, and its N-terminal contains three tetratricopeptide repeat (TPR) motifs. It also contains a RING (really interesting new gene) finger motif, a putative Akt phosphorylation site, and nuclear localization signals.

Imunogênio

TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV

Ações bioquímicas/fisiológicas

TTCR (tetratricopeptide repeat protein 3) interacts with phosphorylated Akt protein, and promotes its ubiquitination and degradation in the nucleus. The expression of TTCR is increased in Down syndrome (DS) cells, and its interaction with Akt protein is thought to be responsible for the clinical symptoms of DS. TTC3-RhoA-CIT-K (citron kinase) pathway is thought to play a key role in neuronal development, and its hyperactivity might result in disruption of normal differentiation.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)