WH0005371M2

Monoclonal Anti-PML antibody produced in mouse

clone 1D12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-MYL, Anti-PP8675, Anti-RNF71, Anti-TRIM19, Anti-promyelocytic leukemia
• Número MDL: MFCD06412254
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1D12, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: mouse, human, rat
• técnica(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC000080
• nº de adesão UniProt: P29590
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PML(5371)

Descrição

Descrição geral

Promyelocytic leukemia (PML) is a 70 KDa protein, made of 560 amino acids.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.

Imunogênio

PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV

Ações bioquímicas/fisiológicas

Promyelocytic leukemia (PML) helps in the complete formation of the nuclear body. It can serve as a transcriptional cofactor. PML plays major roles in modulating cell morphology, proliferation and migration. It has the capability to block the ubiquitination and proteasomal degradation processes. Cytoplasmic PML is required to control TGF-β1 (transforming growth factor β 1) signaling.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)