WH0005026M1

Monoclonal Anti-P2RX5 antibody produced in mouse

clone 1C5, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-MGC47755, Anti-P2X5, Anti-P2X5R, Anti-purinergic receptor P2X, ligand-gated ion channel, 5
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1C5, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: NM_002561
• nº de adesão UniProt: Q93086
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... P2RX5(5026)

Descrição

Descrição geral

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Imunogênio

P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP

Ações bioquímicas/fisiológicas

P2RX5 (Purinergic receptor P2X, ligand-gated ion channel, 5) functions as a ATP-gated ion channel. In humans, it is predicted to form trimeric structure with another member of this family, P2X1. Upregulated P2RX5 expression has been observed during CD4⁺ T cell activation. It has been studied that activated P2RX5 plays an important role in the T cell polarity and immunoregulation, when it is recruited to the surface of the activated CD4⁺ T cells.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)