Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

WH0004684M1

Sigma-Aldrich

Monoclonal Anti-NCAM1 antibody produced in mouse

clone 3G12, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-CD56, Anti-MSK39, Anti-NCAM, Anti-neural cell adhesion molecule 1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3G12, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

BC047244

nº de adesão UniProt

P13591

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NCAM1(4684)

Descrição geral

Neural cell adhesion molecule (NCAM/CD56) is a calcium-independent binding protein. It is located on human chromosome 11q23.1. This molecule belongs to the immunoglobulin superfamily. NCAM1 is present in neurons and glial cells.

Imunogênio

NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP

Ações bioquímicas/fisiológicas

Neural cell adhesion molecule (NCAM/CD56) participates in homophilic cell–cell and heterophilic cell–matrix interactions. It controls the movement of cells and condensation during skeletal development. This protein participates in synaptic plasticity, neurodevelopment and neurogenesis.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

recomendado

Nº do produto
Descrição
Preços

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

NCAM1 association study of bipolar disorder and schizophrenia: polymorphisms and alternatively spliced isoforms lead to similarities and differences
Atz ME, et al.
Psychiatric Genetics, 17(2), 55-67 (2007)
Expression of neural cell adhesion molecule and polysialic acid in human bone marrow-derived mesenchymal stromal cells
Skog MS, et al.
Stem Cell Research & Therapy, 7(1), 113-113 (2016)
Syh-Jae Lin et al.
Immunologic research, 60(1), 105-111 (2014-02-12)
CD4(+)CD25(+) regulatory T cells (Treg), if properly expanded from umbilical cord blood (UCB), may provide a promising immunotherapeutic tool. Our previous data demonstrated that UCB CD4(+)CD25(+) T cells with 4-day stimulation have comparable phenotypes and suppressive function to that of
Tomoko Ohtani et al.
International journal of oncology, 45(5), 2051-2057 (2014-08-15)
Conventional cancer treatments are surgery, radiotherapy, and chemotherapy, but treatment efficiency is insufficient and cancer recurrence is common. Immunotherapy has been added as an important cancer treatment component, but no reports on its efficacy in oral and maxillofacial cancers exist.
Sanna Hämäläinen et al.
Journal of medical virology, 86(8), 1412-1420 (2014-03-13)
Enterovirus infections are usually mild but can also cause severe illnesses and play a role in chronic diseases, such as cardiomyopathies and type 1 diabetes. Host response to the invading virus can markedly modulate the course of the infection, and
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica