WH0003034M4

Monoclonal Anti-HAL antibody produced in mouse

clone 4F2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-HIS, Anti-HSTD, Anti-histidine ammonia-lyase
• Número MDL: MFCD02096540
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4F2, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_002108
• nº de adesão UniProt: P42357
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HAL(3034)

Descrição

Descrição geral

Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids (provided by RefSeq)

Imunogênio

HAL (NP_002099, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)