WH0002940M1

Monoclonal Anti-GSTA3 antibody produced in mouse

clone 1F11, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-GSTA33, Anti-GTA3, Anti-MGC22232, Anti-glutathione S-transferase A3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1F11, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC020619
• nº de adesão UniProt: Q16772
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GSTA3(2940)

Descrição

Descrição geral

Glutathione S-transferase alpha 3 (GSTA3) has two isoforms, that is cytosolic and membrane-bound, which are encoded by two distinct supergene families. These enzymes are involved in cellular defence against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyses the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. (provided by RefSeq)GSTA3 is a adipocyte differentiation-associated protein. It is expressed in steroidogenic tissues. The protein belongs to the family of detoxifying and cytoprotective enzymes.

Imunogênio

GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Ações bioquímicas/fisiológicas

Glutathione S-transferase alpha 3 (GSTA3) is involved in the metabolism of electrophilic xenobiotic and endobiotic toxic compounds. It may be used as a target for prescribing medication in steroid hormone-dependent diseases. This protein is related to diseases associated with oxidation-regulating proteins. It is used as a therapeutic target for renal interstitial fibrosis (RIF).

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)