WH0001434M1

Monoclonal Anti-CSE1L antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-CAS, Anti-CSE1, Anti-CSE1 chromosome segregation 1-like (yeast), Anti-XPO2
• Número MDL: MFCD01633086
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2B7, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: NM_001316
• nº de adesão UniProt: P55060
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CSE1L(1434)

Descrição

Descrição geral

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. (provided by RefSeq)

Imunogênio

CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)