Todas as fotos(2)

Documentos Principais

WH0001111M5

Monoclonal Anti-CHEK1 antibody produced in mouse

Name: Monoclonal Anti-CHEK1 antibody produced in mouse
Brand: SIGMA

clone 2G3, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-CHK1, Anti-CHK1 checkpoint homolog (S. pombe)

Faça loginpara ver os preços organizacionais e de contrato

Todas as fotos(2)

About This Item

Número MDL:

MFCD02262709

Código UNSPSC:

12352203

NACRES:

NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2G3, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunofluorescence: suitable
indirect ELISA: suitable

Isotipo

IgG2bκ

nº de adesão GenBank

BC004202

nº de adesão UniProt

O14757

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHEK1(1111)

Categorias relacionadas

Antibodies - Primary, Secondary & Recombinant Monoclonal

Exclusive Savings

Primary Antibodies

Imunogênio

CHEK1 (AAH04202, 361 a.a. ~ 476 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

07096-2G3

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Most hydrogen peroxide-induced histone H2AX phosphorylation is mediated by ATR and is not dependent on DNA double-strand breaks.

Takanori Katsube et al.

Journal of biochemistry, 156(2), 85-95 (2014-04-01)

The nuclear foci of phosphorylated histone H2AX (γH2AX) are frequently used as a marker for DNA double-strand breaks (DSBs) following ionizing radiation (IR). However, recent studies reported that γH2AX foci do not necessarily correlate with DSBs under other conditions. We

Checkpoint kinase 1 is negatively regulated by miR-497 in hepatocellular carcinoma.

Yin Xie et al.

Medical oncology (Northwood, London, England), 31(3), 844-844 (2014-01-28)

Checkpoint kinase 1 (CHEK1) is an evolutionarily conserved Ser/Thr kinase, which mediates cell-cycle arrest after DNA damage, and we previously reported that CHEK1 was overexpressed and associated with poor prognosis in hepatocellular carcinoma (HCC), indicating it was oncogenic gene. In

Prostate cancer stem-like cells proliferate slowly and resist etoposide-induced cytotoxicity via enhancing DNA damage response.

Judy Yan et al.

Experimental cell research, 328(1), 132-142 (2014-08-26)

Despite the development of chemoresistance as a major concern in prostate cancer therapy, the underlying mechanisms remain elusive. In this report, we demonstrate that DU145-derived prostate cancer stem cells (PCSCs) progress slowly with more cells accumulating in the G1 phase

Decreased DNA repair activity in bone marrow due to low expression of DNA damage repair proteins.

Eui Young So et al.

Cancer biology & therapy, 15(7), 906-910 (2014-04-24)

The bone marrow (BM) is one of the organs that is sensitive to acute exposure of ionizing radiation (IR); however, the mechanism of its high sensitivity to IR remains to be elucidated. BM is differentiated into dendritic cells (DC) with

Checkpoint kinase inhibitor AZD7762 overcomes cisplatin resistance in clear cell carcinoma of the ovary.

Hiroaki Itamochi et al.

International journal of gynecological cancer : official journal of the International Gynecological Cancer Society, 24(1), 61-69 (2013-12-24)

Checkpoint kinase (Chk) inhibitors are thought to increase the cytotoxic effects of DNA-damaging agents and are undergoing clinical trials. The present study was aimed to assess the potential to use the Chk1 and Chk2 inhibitor, AZD7762, with other anticancer agents

Exibir todos os documentos relacionados

Global Trade Item Number

SKU	GTIN
WH0001111M5-100UG	4061829596422

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica