SAB5702838

Anti-KMT1B / SUV39H2 Antibody, clone 6L2D9, Rabbit Monoclonal

• Sinônimo(s): KMT1B
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 6L2D9, monoclonal
• forma: liquid
• peso molecular: 47 kDa
• reatividade de espécies: human
• concentração: 1.25 mg/mL
• técnica(s): western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
• nº de adesão UniProt: Q9H5I1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SUV39H2(79723)

Descrição

Descrição geral

Histone methyltransferase that specifically trimethylates ′Lys-9′ of histone H3 using monomethylated H3 ′Lys-9′ as substrate. H3 ′Lys-9′ trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5 proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 ′Lys-9′ trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher-order chromatin organization during spermatogenesis. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 ′Lys-9′ trimethylation.

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1