SAB5702757

Anti-UQCRH Antibody, clone 4Z1R9, Rabbit Monoclonal

• Sinônimo(s): QCR6, UQCR8
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 4Z1R9, monoclonal
• forma: liquid
• peso molecular: 11 kDa
• reatividade de espécies: rat, human, rat
• concentração: 0.80 mg/mL
• técnica(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
• nº de adesão UniProt: P07919
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... UQCRH(7388)

Descrição

Descrição geral

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII, ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII and cytochrome c oxidase (complex IV, CIV, that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1-91 of human UQCRH (P07919).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IHC

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1