SAB5702585

Anti-KIFAP3 Antibody, clone 1S7J7, Rabbit Monoclonal

• Sinônimo(s): FLA3, KAP-1, KAP-3, KAP3, SMAP, Smg-GDS, dJ190I16.1
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 1S7J7, monoclonal
• Formulário: liquid
• peso molecular: 100 kDa
• reatividade de espécies: rat, rat, human
• concentração: 0.61 mg/mL
• técnica(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: KFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS
• nº de adesão UniProt: Q92845
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KIFAP3(22920)

Descrição

Descrição geral

The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Imunogênio

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845).

Aplicação

WB, IF/ICC

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1