SAB5702582

Anti-Renin Antibody, clone 1L1B7, Rabbit Monoclonal

• Sinônimo(s): HNFJ2
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 1L1B7, monoclonal
• forma: liquid
• peso molecular: 50 kDa
• reatividade de espécies: human
• concentração: 0.68 mg/mL
• técnica(s): western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFK
• nº de adesão UniProt: P00797
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... REN(5972)

Descrição

Descrição geral

Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia. [provided by RefSeq, Jul 2008]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renin (P00797).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1