SAB5702439

Anti-PFKFB3 Antibody, clone 7X10D9, Rabbit Monoclonal

• Sinônimo(s): IPFK2, PFK2, iPFK-2
• Código UNSPSC: 12352203
• NACRES: NA.46
• clone: 7X10D9, monoclonal
• application: IHC; IP; WB
• reatividade de espécies: mouse, mouse
• técnica(s): immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 7X10D9, monoclonal
• Formulário: liquid
• peso molecular: 60 kDa
• reatividade de espécies: mouse, mouse
• concentração: 1 mg/mL
• técnica(s): immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT
• nº de adesão UniProt: Q16875
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PFKFB3(5209)

Descrição

Descrição geral

The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2016]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IHC, IP

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3