SAB5702264

Anti-TIMP2 Antibody, clone 8R5Q2, Rabbit Monoclonal

• Sinônimo(s): TIMP2,CSC-21K,DDC8
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 8R5Q2, monoclonal
• Formulário: liquid
• peso molecular: 22 kDa
• reatividade de espécies: African green monkey, rat, mouse, human
• concentração: 1.00 mg/mL
• técnica(s): western blot: 1:500 - 1:1000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
• nº de adesão UniProt: P16035
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TIMP2(7077)

Descrição

Descrição geral

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.

Imunogênio

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant protein of human TIMP2.

Aplicação

WB

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3