SAB5702254

Anti-SST Antibody

rabbit monoclonal, 7Q4T0

• Sinônimo(s): SST,SMST
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• Nome do produto: Anti-Somatostatin (SST) Antibody, clone 7Q4T0, Rabbit Monoclonal,
• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 7Q4T0, monoclonal
• Formulário: liquid
• reatividade de espécies: mouse, rat
• concentração: 1 mg/mL
• técnica(s): immunohistochemistry: 1:50 - 1:200
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• nº de adesão UniProt: P61278
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SST(6750)

Descrição

Descrição geral

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Imunogênio

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).

Aplicação

IHC

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3