SAB2108487

Anti-BTG2

affinity isolated antibody

• Sinônimo(s): Anti- MGC126064, Anti- PC3, Anti- TIS21, Anti-MGC126063
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 17 kDa
• reatividade de espécies: rat, human
• concentração: 0.5-1 mg/mL
• técnica(s): immunoblotting: suitable
• nº de adesão: NM_006763
• nº de adesão UniProt: P78543
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... BTG2(7832)

Descrição

Descrição geral

B-cell translocation gene 2 (BTG2) belongs to the BTG/TOB gene family. It is also called as nerve growth factor (NGF)-inducible anti-proliferative protein PC3 and NGF-inducible protein TIS21. BTG2 encodes a 158 amino acid protein. This gene is located on the long arm of human chromosome 1.

Imunogênio

Synthetic peptide directed towards the middle region of human BTG2

Ações bioquímicas/fisiológicas

B-cell translocation gene 2 (BTG2) is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
It participates in the modulation of cell cycle transition. It has the ability to repress the migration and invasion of osteosarcoma cells.

Sequência

Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable