SAB2103606

Anti-SMYD2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-HSKM-B, Anti-KMT3C, Anti-MGC119305, Anti-ZMYND14
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ChIP; WB
• clone: polyclonal
• reatividade de espécies: pig, bovine, dog, rabbit, horse, human, rat, mouse
• técnica(s): ChIP: suitable; western blot: suitable

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 50 kDa
• reatividade de espécies: pig, bovine, dog, rabbit, horse, human, rat, mouse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): ChIP: suitable; western blot: suitable
• nº de adesão NCBI: NM_020197
• nº de adesão UniProt: Q9NRG4
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SMYD2(56950)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human SMYD2

Ações bioquímicas/fisiológicas

SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).[supplied by OMIM].

Sequência

Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable