Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

SAB2102181

Sigma-Aldrich

Anti-SLC24A6 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-FLJ22233, Anti-NCKX6, Anti-NCLX, Anti-Solute carrier family 24, member 6

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

64 kDa

reatividade de espécies

human, rabbit, rat, guinea pig, bovine, mouse, dog, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão UniProt

Q6J4K2

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SLC24A6(80024)

Descrição geral

Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX). NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).

Imunogênio

Synthetic peptide directed towards the middle region of human SLC24A6

Aplicação

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

Ações bioquímicas/fisiológicas

Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.

Sequência

Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Marko Kostic et al.
Seminars in cell & developmental biology, 94, 59-65 (2019-01-19)
Mitochondrial Ca2+ transient is the earliest discovered organellar Ca2+ signaling pathway. It consist of a Ca2+ influx, mediated by mitochondrial Ca2+ uniporter (MCU), and mitochondrial Ca2+ efflux mediated by a Na+/Ca2+ exchanger (NCLX). Mitochondrial Ca2+ signaling machinery plays a fundamental
Marko Kostic et al.
Cell reports, 25(12), 3465-3475 (2018-12-20)
Calcium is a key regulator of mitochondrial function under both normal and pathological conditions. The mechanisms linking metabolic activity to mitochondrial Ca2+ signaling remain elusive, however. Here, by monitoring mitochondrial Ca2+ transients while manipulating mitochondrial membrane potential (ΔΨm), we found
Olha M Koval et al.
Science signaling, 12(579) (2019-05-02)
The role of the mitochondrial Ca2+ uniporter (MCU) in physiologic cell proliferation remains to be defined. Here, we demonstrated that the MCU was required to match mitochondrial function to metabolic demands during the cell cycle. During the G1-S transition (the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica