SAB2100585

Anti-DIS3 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-DIS3 mitotic control homolog (S. cerevisiae), Anti-DKFZp667L1817, Anti-FLJ10484, Anti-KIAA1008, Anti-MGC33035
• Código UNSPSC: 12352203
• NACRES: NA.41
• clone: polyclonal
• application: WB
• reatividade de espécies: human
• técnica(s): western blot: suitable

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 109 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão UniProt: Q9Y2L1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... DIS3(22894)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human DIS3

Ações bioquímicas/fisiológicas

DIS3, belonging to the ribonuclease II (RNB) family, has a 3′-5′ exonuclease activity. It is a catalytic component of the exosome 3′→5′ exoribonuclease complex required for the 3′-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Sequência

Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable