Pular para o conteúdo
Merck
Todas as fotos(2)

Key Documents

SAB1412317

Sigma-Aldrich

ANTI-T antibody produced in mouse

clone 1H1, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

MGC104817, T, TFT

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1H1, monoclonal

forma

buffered aqueous solution

peso molecular

antigen 36.63 kDa

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão NCBI

NM_003181

nº de adesão UniProt

O15178

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... T(6862)

Descrição geral

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. (provided by RefSeq)

Imunogênio

T (NP_003172, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW

forma física

Solution in phosphate buffered saline, pH 7.4

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Diana L Castillo-Carranza et al.
Journal of Alzheimer's disease : JAD, 40 Suppl 1, S97-S111 (2014-03-08)
Neurodegenerative disease is one of the greatest health crises in the world and as life expectancy rises, the number of people affected will continue to increase. The most common neurodegenerative disease, Alzheimer's disease, is a tauopathy, characterized by the presence
T B Smith et al.
Andrology, 2(5), 755-762 (2014-08-02)
We have shown previously that a network of mononuclear phagocytes (MPs) expressing macrophage and dendritic cell markers such as CD11c, F4/80 and CX3CR1, lines the base of the epididymal tubule. However, in the initial segment (IS) and only in that
Jessica Oenarto et al.
Archives of biochemistry and biophysics, 560, 59-72 (2014-07-09)
This study characterizes the expression of the osmolyte transporters betaine/γ-amino-n-butyric acid (GABA) transporter (BGT-1), the taurine transporter (TauT) and the sodium-dependent myo-inositol transporter (SMIT) in various rat brain cells in culture and in rat and human cerebral cortex in situ.
Akiko Ohtani et al.
Neuroscience research, 81-82, 11-20 (2014-04-05)
Serotonin (5-HT) regulates the development of cerebral cortex, but 5-HT receptors mediating the effects are poorly understood. We investigated roles of 5-HT2A receptor in dendritic growth cones using dissociation culture of rat cerebral cortex. Neurons at embryonic day 16 were
Olga Wiens et al.
PloS one, 9(7), e103821-e103821 (2014-08-01)
The invasion of Theileria sporozoites into bovine leukocytes is rapidly followed by the destruction of the surrounding host cell membrane, allowing the parasite to establish its niche within the host cell cytoplasm. Theileria infection induces host cell transformation, characterised by

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica