SAB1412248

ANTI-RUNX2 antibody produced in mouse

clone 4D7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): AML3, CBFA1, CCD, CCD1, RUNX2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4D7, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 41.14 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão NCBI: NM_001024630
• nº de adesão UniProt: Q13950
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... RUNX2(860)

Descrição

Descrição geral

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. (provided by RefSeq)

Imunogênio

RUNX2 (NP_001019801.1, 311 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable