SAB1410844

Anti-NNMT antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: antigen 29.6 kDa
• reatividade de espécies: human, mouse
• técnica(s): western blot: 1 μg/mL
• nº de adesão NCBI: NM_006169.2
• nº de adesão UniProt: P40261
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NNMT(4837)

Descrição

Descrição geral

The nicotinamide N-methyltransferase (NNMT) gene, spanning 16.5kb of genomic DNA with three exons and two introns, is mapped to human chromosome 11q23.1. The encoded protein consists of 264 amino acids with a predicted molecular mass of 29.6kDa. NNMT is expressed in cytoplasm.

Imunogênio

NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.

Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Ações bioquímicas/fisiológicas

Nicotinamide N-methyltransferase (NNMT) is a cytosolic methyltransferase enzyme. It catalyzes the N-methylation of nicotinamide, pyridines and other structural analogs. Hence, it plays a vital role in the biotransformation and detoxification of various xenobiotic compounds. Altered expression of the gene is associated with the pathogenesis of various diseases such as acute lymphoblastic leukemia (ALL), parkinson′s disease, thyroid cancer, gastric cancer, colorectal cancer, lung, liver and oral carcinomas. In addition, variation in the gene might increase the risk of susceptibility to hyperlipidemia and migraine.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable