Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

SAB1404890

Sigma-Aldrich

Monoclonal Anti-NUDT21 antibody produced in mouse

clone 3F8, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

CFIM25, CPSF5, DKFZp686H1588

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3F8, monoclonal

Formulário

buffered aqueous solution

peso molecular

antigen ~51.08 kDa

reatividade de espécies

human

técnica(s)

capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NUDT21(11051)

Descrição geral

The protein encoded by this gene is one subunit of a cleavage factor required for 3′ RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3′ end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. (provided by RefSeq)

Imunogênio

NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Aplicação

Monoclonal Anti-NUDT21 antibody produced in mouse is suitable for capture ELISA, immunohistochemistry (formalin-fixed, paraffin-embedded sections), and indirect ELISA.

Ações bioquímicas/fisiológicas

NUDT21 (Nudix hydrolase 21) plays an essential role in the regulation of pre-messenger RNA 3′-end processing phenomena. It performs in the polyadenylation and cleavage process via various protein-protein interactions. It can directly interact with RNA, poly(A) polymerase, and the nuclear poly(A)-binding protein. The catalytic nudix fold binds to the nucleotide during the polyadenylation and/or cleavage steps of pre-messenger RNA 3′-end processing.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

The crystal structure of human cleavage and polyadenylation specific factor-5 reveals a dimeric Nudix protein with a conserved catalytic site.
Lionel Trésaugues et al.
Proteins, 73(4), 1047-1052 (2008-09-04)
David Alejandro Bejarano et al.
eLife, 8 (2019-01-24)
Nuclear entry of HIV-1 replication complexes through intact nuclear pore complexes is critical for successful infection. The host protein cleavage-and-polyadenylation-specificity-factor-6 (CPSF6) has been implicated in different stages of early HIV-1 replication. Applying quantitative microscopy of HIV-1 reverse-transcription and pre-integration-complexes (RTC/PIC)
Molly Coseno et al.
Nucleic acids research, 36(10), 3474-3483 (2008-05-01)
Cleavage factor I(m) is an essential component of the pre-messenger RNA 3'-end processing machinery in higher eukaryotes, participating in both the polyadenylation and cleavage steps. Cleavage factor I(m) is an oligomer composed of a small 25 kDa subunit (CF I(m)25)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica