SAB1404696

Monoclonal Anti-MAPKAPK2 antibody produced in mouse

clone 3B8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): MK2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3B8, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~35.57 kDa
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_032960
• nº de adesão UniProt: P49137
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MAPKAPK2(9261)

Descrição

Descrição geral

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)The gene is located on human chromosome 1q32.1. It consists of an autoinhibitory domain, a helix-turn-helix structure, which occupies the substrate binding cleft of the kinase domain and inhibits kinase function.

Imunogênio

MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Ações bioquímicas/fisiológicas

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) is involved in cytokine production and cell migration. Overexpression of MAPKAPK2 confers multiple myeloma (MM) resistance to chemotherapy. It phosphorylates the proteins found in the nucleus and cytoplasm. This protein confers gemcitabine sensitivity in pancreatic cancer cells. The protein is required for tumor necrosis factor (TNF) biosynthesis. It is linked to tumorigenesis and drug resistance. The protein functions as a prognostic marker for lung cancer.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable