SAB1404682

Monoclonal Anti-EXO1, (C-terminal) antibody produced in mouse

clone 1H6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): HEX1, hExoI
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1H6, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~37 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão NCBI: BC007491
• nº de adesão UniProt: Q9UQ84
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EXO1(9156)

Descrição

Descrição geral

This gene encodes a protein with 5′ to 3′ exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. (provided by RefSeq)

Imunogênio

EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable