SAB1403747

Monoclonal Anti-DUSP3 antibody produced in mouse

clone 5B7, ascites fluid

• Sinônimo(s): VHR
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); WB
• clone: 5B7, monoclonal
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: ascites fluid
• tipo de produto de anticorpo: primary antibodies
• clone: 5B7, monoclonal
• peso molecular: antigen ~46.46 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• nº de adesão NCBI: BC002682
• nº de adesão UniProt: P51452
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... DUSP3(1845)

Descrição

Descrição geral

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. (provided by RefSeq)

Imunogênio

DUSP3 (AAH02682, 1 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

forma física

Clear solution

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable