SAB1403200

Monoclonal Anti-SULT1B1, (N-terminal) antibody produced in mouse

clone 4C9, ascites fluid

• Sinônimo(s): MGC13356, ST1B2, SULT1B2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: ascites fluid
• tipo de produto de anticorpo: primary antibodies
• clone: 4C9, monoclonal
• peso molecular: antigen ~37 kDa
• reatividade de espécies: human
• técnica(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgMκ
• nº de adesão NCBI: NM_014465
• nº de adesão UniProt: O43704
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SULT1B1(27284)

Descrição

Descrição geral

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. (provided by RefSeq)

Imunogênio

SULT1B1 (NP_055280.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK

forma física

Clear solution

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable