SAB1403099

Monoclonal Anti-SBLF antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): DKFZp781K2462, MGC149803, MGC149804, SBLF, STN1, STNB1, stoned-b1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1F3, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~36.23 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006873
• nº de adesão UniProt: Q9Y6Q2
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... STON1(11037)

Descrição

Descrição geral

Endocytosis of cell surface proteins is mediated by a complex molecular machinery that assembles on the inner surface of the plasma membrane. This gene encodes one of two human homologs of the Drosophila melanogaster stoned B protein. This protein is related to components of the endocytic machinery and exhibits a modular structure consisting of an N-terminal proline-rich domain, a central region of homology specific to the human stoned B-like proteins, and a C-terminal region homologous to the mu subunits of adaptor protein (AP) complexes. Co-transcription of this gene and the neighboring downstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

Imunogênio

SBLF (NP_006864, 529 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable