SAB1402761

Monoclonal Anti-EFNA3 antibody produced in mouse

clone 1C12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): EFL2, EPLG3, Ehk1-L, LERK3
• Código UNSPSC: 12352203
• NACRES: NA.41
• clone: 1C12, monoclonal
• application: ELISA (c); ELISA (i); IP
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1C12, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~52.29 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable
• Isotipo: IgG1κ
• nº de adesão NCBI: BC017722
• nº de adesão UniProt: P52797
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EFNA3(1944)

Descrição

Descrição geral

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. (provided by RefSeq)

Imunogênio

EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable