SAB1402490

Monoclonal Anti-ENDOGL1, (C-terminal) antibody produced in mouse

clone 2F7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): ENDOGL1, ENDOGL2, ENGL, ENGL-B, ENGL-a, MGC125944, MGC125945
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); IF; IHC (p); WB
• clone: 2F7, monoclonal
• reatividade de espécies: mouse, human, rat
• técnica(s): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2F7, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: mouse, human, rat
• técnica(s): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_005107
• nº de adesão UniProt: Q9Y2C4
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EXOG(9941)

Descrição

Descrição geral

This gene encodes an endo/exonuclease with 5′-3′ exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5′ end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18. (provided by RefSeq)

Imunogênio

ENDOGL1 (NP_005098.1, 269 a.a. ~ 368 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 13 - Non Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable