SAB1402361

Monoclonal Anti-SOX10 antibody produced in mouse

clone 1E6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): DOM, MGC15649, WS2E, WS4
• Número MDL: MFCD03097283
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1E6, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~36.89 kDa
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006941
• nº de adesão UniProt: P56693
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SOX10(6663)

Descrição

Descrição geral

Anti-AURA Antibody detects endogenous levels of total AURA protein.

SOX10 (SRY-box 10) is a co-transcription factor that is located on human chromosome 22q13. SOX10 is temporarily expressed in melanoblasts.

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. (provided by RefSeq)

Imunogênio

SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR

Ações bioquímicas/fisiológicas

SOX10 (SRY-box 10) regulates the expression of ErbB3 in neural crest cells. It is required for differentiation of peripheral glia. SOX10 plays an important role in the progression of melanocytes. Mutations in SOX10 result in Waardenburg syndrome and Hirschsprung disease.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable