SAB1402166

Monoclonal Anti-CYP2D6 antibody produced in mouse

clone 2C5, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): CPD6, CYP2D, CYP2D@, CYP2DL1, MGC120389, MGC120390, P450-DB1, P450C2D, P450DB1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2C5, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NG_003180
• nº de adesão UniProt: P10635
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CYP2D6(1565)

Descrição

Descrição geral

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme′s substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Imunogênio

CYP2D6 (NP_000097, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLT

Ações bioquímicas/fisiológicas

CYP2D6 is involved in drug metabolism. Mutations in CYP2D6 is associated with esophageal squamous cell carcinoma. CYP2D6 participates in the production of endoxifen, which is an active metabolite of tamoxifen. CYP2D6 is involved in the biotransformation of codeine to morphine in the liver to produce analgesic effects.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable