Todas as fotos(3)

Documentos Principais

SAB1402140

Monoclonal Anti-CAT, (N-terminal) antibody produced in mouse

Name: Monoclonal Anti-CAT, (N-terminal) antibody produced in mouse
Brand: SIGMA

clone 2G6, purified immunoglobulin, buffered aqueous solution

Faça loginpara ver os preços organizacionais e de contrato

Todas as fotos(3)

About This Item

Código UNSPSC:

12352203

NACRES:

NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2G6, monoclonal

forma

buffered aqueous solution

peso molecular

antigen ~37.11 kDa

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão NCBI

NM_001752

nº de adesão UniProt

P04040

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CAT(847)

Imunogênio

CAT (NP_001743, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF

forma física

Solution in phosphate buffered saline, pH 7.4

Não está encontrando o produto certo?

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

13 - Non Combustible Solids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Selective inhibition of class I but not class IIb histone deacetylases exerts cardiac protection from ischemia reperfusion.

Sverre E Aune et al.

Journal of molecular and cellular cardiology, 72, 138-145 (2014-03-19)

While inhibition of class I/IIb histone deacetylases (HDACs) protects the mammalian heart from ischemia reperfusion (IR) injury, class selective effects remain unexamined. We hypothesized that selective inhibition of class I HDACs would preserve left ventricular contractile function following IR in

TraK and TraB are conserved outer membrane proteins of the Neisseria gonorrhoeae Type IV secretion system and are expressed at low levels in wild-type cells.

Meghan E Ramsey et al.

Journal of bacteriology, 196(16), 2954-2968 (2014-06-11)

Neisseria gonorrhoeae uses a type IV secretion system (T4SS) to secrete chromosomal DNA into the medium, and this DNA is effective in transforming other gonococci via natural transformation. In addition, the T4SS is important in the initial stages of biofilm

Blue light-induced oxidative stress in human corneal epithelial cells: protective effects of ethanol extracts of various medicinal plant mixtures.

Jee-Bum Lee et al.

Investigative ophthalmology & visual science, 55(7), 4119-4127 (2014-06-14)

To investigate the effects of visible light on human corneal epithelial cells and the impact of natural antioxidants on oxidative stress produced by overexposure to light. Light-emitting diodes with various wavelengths (410-830 nm) were used to irradiate human corneal epithelial

SIRT3 positively regulates the expression of folliculogenesis- and luteinization-related genes and progesterone secretion by manipulating oxidative stress in human luteinized granulosa cells.

Houju Fu et al.

Endocrinology, 155(8), 3079-3087 (2014-06-01)

SIRT3 is a member of the sirtuin family and has recently emerged as a vital molecule in controlling the generation of reactive oxygen species (ROS) in oocytes. Appropriate levels of ROS play pivotal roles in human reproductive medicine. The aim

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica