SAB1401383
Anti-TFAM antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
reatividade de espécies
mouse, human
técnica(s)
western blot: 1 μg/mL
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TFAM(7019)
Descrição geral
Mitochondrial transcription factor A (TFAM) is a high-mobility group (HMG) protein and is made up of two HMG-box domains. The TFAM gene is located on the human chromosome at 10q21.1.
Imunogênio
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Aplicação
Anti-TFAM antibody produced in rabbit has been used in western blotting (1:1000) and immunofluorescence.
Ações bioquímicas/fisiológicas
Mitochondrial transcription factor A (TFAM) is involved in mitochondrial DNA (mtDNA) synthesis, expression, and packaging. It is also involved in regulating the aggregation of mtDNA. TFAM stabilizes the mtDNA by binding to it in a sequence-depending manner and forms a nucleoid.
forma física
Solution in phosphate buffered saline, pH 7.4
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Maik Hüttemann et al.
Clinical science (London, England : 1979), 124(11), 663-674 (2012-12-21)
Alternative approaches to reduce congenital muscle dysfunction are needed in cases where the ability to exercise is limited. (-)-Epicatechin is found in cocoa and may stimulate capillarity and mitochondrial proliferation in skeletal muscle. A total of 21 male rats bred
Victoria Alvarez et al.
Journal of Alzheimer's disease : JAD, 13(3), 275-280 (2008-04-24)
Impaired mitochondrial function and an increased number of mutations in mitochondrial DNA (mtDNA) has been found in brains of patients with late-onset Alzheimer's disease (LOAD). The TFAM-gene encodes the mitochondrial transcription factor A, a protein that controls the transcription, replication
Ryan Neil Marshall et al.
Frontiers in physiology, 13, 1097988-1097988 (2023-01-24)
Background: Ageing is associated with alterations to skeletal muscle oxidative metabolism that may be influenced by physical activity status, although the mechanisms underlying these changes have not been unraveled. Similarly, the effect of resistance exercise training (RET) on skeletal muscle
Leonardo Nogueira et al.
The Journal of physiology, 589(Pt 18), 4615-4631 (2011-07-27)
The flavanol (-)-epicatechin, a component of cacao (cocoa), has been shown to have multiple health benefits in humans. Using 1-year-old male mice, we examined the effects of 15 days of (-)-epicatechin treatment and regular exercise on: (1) exercise performance, (2)
Yoshiyuki Ikeda et al.
Circulation research, 116(2), 264-278 (2014-10-22)
Both fusion and fission contribute to mitochondrial quality control. How unopposed fusion affects survival of cardiomyocytes and left ventricular function in the heart is poorly understood. We investigated the role of dynamin-related protein 1 (Drp1), a GTPase that mediates mitochondrial
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica