SAB1401214

Anti-IL12RB1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): CD212, IL-12R-BETA1, IL12RB, MGC34454
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): western blot: 1 μg/mL
• nº de adesão NCBI: BC029121
• nº de adesão UniProt: P42701
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... IL12RB1(3594)

Descrição

Descrição geral

IL12RB1 (interleukin 12 receptor subunit β1) gene is mapped to human chromosome 19p13.11. The encoded protein is a member of type I transmembrane receptors.

Rabbit polyclonal antibody raised against a full-length human IL12RB1 protein.

Imunogênio

IL12RB1 (AAH29121.1, 1 a.a. ~ 381 a.a) full-length human protein.

Sequence
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

Ações bioquímicas/fisiológicas

IL12RB1 (interleukin 12 receptor subunit β1) regulates the physiological responses to a number of diseases. IL12RB1 binds to both IL 12 (interleukin 12) and IL 23 (interleukin 23) at a common binding point 12p40-domain.Variation in the gene affects the receptor sensitivity towards the cytokines IL 12 and IL 23. Thus, the gene is associated with the diseases that are regulated by IL 12 and IL 23. Susceptibility to diseases such as tuberculosis, nontuberculous mycobacterial infection, malaria, cancer, pediatric asthma, and atopic dermatitis is related to IL12RB1.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable