MSST0064
SILu™Prot Insulin, human
recombinant, expressed in Pichia pastoris, SIL MS Protein Standard, 15N -labeled
Sinônimo(s):
in situ Proximity Ligation Assay reagent, Insulin
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
recombinante
expressed in Pichia pastoris
Nível de qualidade
Ensaio
≥95% (HPLC)
Formulário
dry pellets
potência
≥97% (Heavy amino acids incorporation efficiency by MS)
adequação
suitable for mass spectrometry (standard)
nº de adesão UniProt
Condições de expedição
ambient
temperatura de armazenamento
−20°C
Informações sobre genes
human ... INS(3630)
Categorias relacionadas
Descrição geral
SILu™ Prot Insulin is a recombinant, stable 15N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu™ Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not 15N labeled).
Ações bioquímicas/fisiológicas
Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.
Sequência
A chain: GIVEQCCTSICSLYQLENYCN
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
forma física
Supplied as dried pellet from a solution containing 1% acetic acid.
Informações legais
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
nwg
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica