MSST0059
SILu™Prot CST3, Cystatin C human
recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled
Sinônimo(s):
CST3, Cystatin C
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
23201100
NACRES:
NA.32
Produtos recomendados
recombinante
expressed in E. coli
Nível de qualidade
Ensaio
≥95% (SDS-PAGE)
forma
lyophilized powder
potência
≥97% (Heavy amino acids incorporation efficiency by MS)
adequação
suitable for mass spectrometry (standard)
nº de adesão UniProt
Condições de expedição
ambient
temperatura de armazenamento
−20°C
Informações sobre genes
human ... CST3(1471)
Categorias relacionadas
Descrição geral
SILu™Prot CST3 is a recombinant, stable 15N isotope-labeled human CST3. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of CST3 in mass-spectrometry. SILu™Prot CST3 is a protein of 120 amino acids, with a calculated molecular mass of 13.5 kDa.
Ações bioquímicas/fisiológicas
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Sequência
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
forma física
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Informações legais
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 2
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica