Pular para o conteúdo
Merck
Todas as fotos(5)

Key Documents

HPA041309

Sigma-Aldrich

Anti-BICD1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Bicaudal d homolog 1 (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

sequência de imunogênio

YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... BICD1(636)

Descrição geral

The gene BICD1 (BICD cargo adaptor 1) is mapped to human chromosome 12p11. It is a coiled-coil protein.
BICD1 protein interacts with:

Imunogênio

bicaudal D homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-BICD1 antibody produced in rabbit has been used in western blotting and immunofluorescence.

Ações bioquímicas/fisiológicas

BICD1 (BICD cargo adaptor 1) is needed for transport of mRNA transcripts and retrograde trafficking of vesicles from the Golgi to the endoplasmic reticulum. It interacts with Rab6B (Ras-related protein) to control retrograde transport of cargo in neuronal cells. It plays an important role in dynein function by forming a complex with dynein–dynactin. Dynein is needed for mitosis, nuclear migration, mRNA movements and axonal and dendritic vesicles transport. BICD1 also controls PAR1 (protease-activated receptor 1)-G protein signaling and endocytosis. PAR1 is a G protein-associated receptor which has important roles in cancer, angiogenesis, inflammation and thrombosis. BICD1 polymorphism rs2630778 is associated with telomere shortening. In addition, it is one of the susceptibility gene for emphysema.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST81102

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
Swift S, et al.
The Journal of Biological Chemistry, 285, 11402-11410 (2010)
Genetics of COPD.
Nakamura H, et al.
Allergology International, 60.3, 253-258 (2011)
Liujin Hou et al.
Frontiers in genetics, 13, 979001-979001 (2022-10-11)
Background: Colon cancer is the fifth most common cause of cancer-related death worldwide, and despite significant advances in related treatment, the prognosis of colon cancer patients remains poor. Objective: This study performs systematic bioinformatics analysis of prognostic-associated RNA processing factor
hTERT, BICD1 and chromosome 18 polymorphisms associated with telomere length affect kidney allograft function after transplantation.
Kloda K, et al.
Kidney & Blood Pressure Research, 40, 111-120 (2015)
The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
Short B, et al.
Current Biology, 12, 1792-1792 (2002)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica