Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

HPA034982

Sigma-Aldrich

Anti-ABCB7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-ABC7, Anti-ASAT, Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 7, Anti-Atm1p, Anti-EST140535

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ABCB7(22)

Descrição geral

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is located in mitochondrial inner membrane and encoded by ABACB7 gene on human chromosome Xq13.3. It has ATP binding cassette domain and belongs to the multidrug resistance/ transporter antigenic peptides MDR/TAP subfamily.

Imunogênio

ATP-binding cassette, sub-family B (MDR/TAP), member 7 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-ABCB7 antibody produced in rabbit has been used for the detection of ABCB7 protein in immunoblotting.

Ações bioquímicas/fisiológicas

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is involved in the transport of heme from the mitochondria to the cytosol. It is also involved in heme biosynthesis and homeostasis. Silencing of ABCB7 RNA and mutations in ABCB7 is implicated in sideroblastic anemia with ataxia. Alternate splicing of ABC7 gene results in premature protein termination and is associated with myelodysplastic syndromes.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST78281

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Involvement of ABC7 in the biosynthesis of heme in erythroid cells: interaction of ABC7 with ferrochelatase
Taketani S, et al.
Blood, 101(8), 3274-3280 (2003)
Cloning and chromosomal mapping of a novel ABC transporter gene (hABC7), a candidate for X-linked sideroblastic anemia with spinocerebellar ataxia
Shimada Y, et al.
Journal of Human Genetics, 43(2), 115-115 (1998)
Cryptic splicing events in the iron transporter ABCB7 and other key target genes in SF3B1-mutant myelodysplastic syndromes
Dolatshad H, et al.
Leukemia, 30(12), 2322-2322 (2016)
The L-cysteine desulfurase NFS1 is localized in the cytosol where it provides the sulfur for molybdenum cofactor biosynthesis in humans
Marelja Z, et al.
PLoS ONE, 8(4), e60869-e60869 (2013)
Human ABC7 transporter: gene structure and mutation causing X-linked sideroblastic anemia with ataxia with disruption of cytosolic iron-sulfur protein maturation
Bekri S, et al.
Blood, 96(9), 3256-3264 (2000)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica