HPA025031

Anti-EIF4G3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinônimo(s): Anti-Eukaryotic translation initiation factor 4 gamma 3, Anti-eIF-4-gamma 3, Anti-eIF-4-gamma II, Anti-eIF-4G 3, Anti-eIF4G 3, Anti-eIF4GII
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA025031
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• técnica(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• sequência de imunogênio: EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
• nº de adesão UniProt: O43432
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EIF4G3(8672)

Descrição

Descrição geral

The gene is EIF4G3 (eukaryotic translation initiation factor 4 γ 3) is mapped to human chromosome 1p36.12. It is widely expressed in human tissues and is a functional homolog of EIF4G1. The encoded protein directly binds to EIF4E (eukaryotic translation initiation factor 4E), EIF4A and EIF3.

Imunogênio

Eukaryotic translation initiation factor 4 gamma 3 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

EIF4G3 (eukaryotic translation initiation factor 4 γ 3) is a crucial component of the translation initiation complex EIF4F (eukaryotic translation initiation factor 4F). During translational initiation, it is responsible for bringing the mRNA. In Drosophila, EIF4G3 also plays a role in spermatogenesis. The EIF4G3 mRNA is a target of tumor suppressor microRNA miR-520c-3p, leading to senescence in tumor cells. The EIF4G3 gene is upregulated in DLBCL (diffuse large B cell lymphoma). Mutation in the gene might be linked with SFG (superior frontal gyrus) volumes which are associated with schizophrenia.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST76527

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable