Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

HPA023882

Sigma-Aldrich

Anti-FAT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Cadherin-related tumor suppressor homolog, Anti-Protein fat homolog, Anti-Protocadherin Fat 1

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:50- 1:200

sequência de imunogênio

NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FAT1(2195)

Descrição geral

FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.

Imunogênio

Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-FAT1 antibody produced in rabbit has been used for western blotting. FAT1 antibody produced in rabbit has been used in immunofluorescence, tissue microarrays (TMAs) and immunohistochemistry (IHC).
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

FAT atypical cadherin 1 (FAT1) acts as a proximal element of cell migration signaling pathways.FAT1 interacts with Ena/Vasodilator-stimulated phosphoprotein (VASP) at the leading edges of lamellipodia, filopodia, and microspike tips and helps in normal actin dynamics and cell polarization. FAT1, with or without β-catenin, might function as a novel biomarker for breast cancer. Mutation of FAT1 gene leads to T-cell acute lymphoblastic leukemia (T-ALL) in adults. In humans, FAT1 might act both as an oncogene and a tumor suppressor. The protein modulates oncogenic pathways in glioma cell lines. FAT1 also act as a co-activator of hypoxia and growth receptor signaling to critical tumorigenic pathways in hepatocellular carcinoma (HCC).

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST85143

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

FAT1 expression and mutations in adult acute lymphoblastic leukemia.
Neumann M
Blood Cancer Journal, 4 (2014)
De-Chen Lin et al.
Nature genetics, 46(8), 866-871 (2014-06-24)
Nasopharyngeal carcinoma (NPC) has extremely skewed ethnic and geographic distributions, is poorly understood at the genetic level and is in need of effective therapeutic approaches. Here we determined the mutational landscape of 128 cases with NPC using whole-exome and targeted
Protocadherin FAT1 binds Ena/VASP proteins and is necessary for actin dynamics and cell polarization.
Moeller MJ
The Embo Journal, 23(19), 3769-3779 (2004)
Podocyte proteins in congenital and minimal change nephrotic syndrome.
Suvanto M, et al.
Clinical and Experimental Nephrology, 19(3), 481-488 (2015)
Loss of FAT1 during the progression from DCIS to IDC and predict poor clinical outcome in breast cancer.
26721716
Wang L
Experimental and Molecular Pathology, 100(1), 177-183 (2016)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica