Pular para o conteúdo
Merck
Todas as fotos(10)

Key Documents

HPA023822

Sigma-Aldrich

Anti-ARFGEF1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinônimo(s):

Anti-Brefeldin A-inhibited GEP 1, Anti-Brefeldin A-inhibited guanine nucleotide-exchange protein 1, Anti-p200 ARF guanine nucleotide exchange factor, Anti-p200 ARF-GEP1

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human, mouse

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

sequência de imunogênio

QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ARFGEF1(10565)

Descrição geral

The gene ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1), also referred to as BIG1 (brefeldin A-inhibited guanine nucleotide-exchange protein), is a guanine nucleotide exchange factor that acts on trans-Golgi. The gene is mapped to human chromosome 8.

Imunogênio

Brefeldin A-inhibited guanine nucleotide-exchange protein 1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-ARFGEF1 antibody produced in rabbit has been used for immunofluorescence. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

The gene ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) encodes an ADP-ribosylation factor that catalyzes the replacement of bound GDP with GTP via the activation of class I ADP-ribosylation factors (ARF1-3). This process is necessary for the regulation of protein transport in eukaryotic cells. It also functions as a scaffolding protein and interacts with various proteins in other compartments of the cell. Knock-down of BIG1 and BIG2, a closely related guanine-nucleotide exchange factor, results in disruption of localization of certain proteins associated with the trans-Golgi network (TGN) and recycling endosomes. The retrograde transport of furin from late endosomes to the TGN is also inhibited in the absences of these two proteins.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST76184

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Dylan Mordaunt et al.
Pediatric neurology, 52(2), 230-234 (2015-02-20)
Cerebellar vermis hypoplasia has been associated with a large number of chromosomal abnormalities and metabolic disorders, with few candidate genes clearly linked to isolated cerebellar vermis hypoplasia. We describe on a 12-year-old boy with inferior vermian hypoplasia associated with a
Ray Ishizaki et al.
Molecular biology of the cell, 19(6), 2650-2660 (2008-04-18)
BIG2 and BIG1 are closely related guanine-nucleotide exchange factors (GEFs) for ADP-ribosylation factors (ARFs) and are involved in the regulation of membrane traffic through activating ARFs and recruiting coat protein complexes, such as the COPI complex and the AP-1 clathrin
Ju Hee Kim et al.
BMB reports, 44(8), 523-528 (2011-08-30)
To identify novel genes that are regulated by promoter methylation, a combinational approach involving in silico mining followed by molecular assay was performed. From the expression microarray data registered in the European bioinformatics institute (EBI), genes showing downregulation in breast

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica