Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

HPA019693

Sigma-Aldrich

Anti-LSP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-47 kDa actin-binding protein, Anti-52 kDa phosphoprotein, Anti-Lymphocyte-specific antigen WP34, Anti-Lymphocyte-specific protein 1, Anti-Protein pp52

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

sequência de imunogênio

PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... LSP1(4046)

Descrição geral

LSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative serine/threonine phosphorylation sites. In addition to these two domains, it has additional Ca2(+)-binding site.
LSP1 gene is mapped to human chromosome 11p15. It has 20 exons.

Imunogênio

Lymphocyte-specific protein 1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-LSP1 antibody produced in rabbit has been used in:
  • immunoprecipitation
  • western blots
  • proximity ligation assay (PLA)

Ações bioquímicas/fisiológicas

LSP1 (Lymphocyte-specific protein 1) is an actin binding protein. It is phosphorylated via MAPKAPK2 (MK2) directed pathway, which further plays a vital role in the F-actin polarization during neutrophil chemotaxis.
LSP1 controls the migration of immune cell in inflammation and phagocytosis. It also modulates cell adhesion.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST74191

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Lymphocyte-specific protein 1 regulates mechanosensory oscillation of podosomes and actin isoform-based actomyosin symmetry breaking
Cervero P, et al.
Nature Communications, 9(515), 1-19 (2018)
Yue Wu et al.
Biochemical and biophysical research communications, 358(1), 170-175 (2007-05-08)
In neutrophils, the major substrate of MAPKAPK2 (MK2) is an F-actin binding protein LSP1. Studies using mutants of the two potential Serine phosphorylation sites in LSP1 C-terminal F-actin binding region indicated that the major phosphorylation site for MK2 is Ser243
Joel Johansson et al.
Frontiers in oncology, 5, 3-3 (2015-02-13)
Breast cancer progression toward metastatic disease is linked to re-activation of epithelial-mesenchymal transition (EMT), a latent developmental process. Breast cancer cells undergoing EMT lose epithelial characteristics and gain the capacity to invade the surrounding tissue and migrate away from the
J Jongstra-Bilen et al.
Journal of immunology (Baltimore, Md. : 1950), 144(3), 1104-1110 (1990-02-01)
With use of the mouse LSP1 cDNA we isolated a human homologue of the mouse LSP1 gene from a human CTL cDNA library. The predicted protein sequence of human LSP1 is compared with the predicted mouse LSP1 protein sequence and
Correlation between LSP1 polymorphisms and the susceptibility to breast cancer
Chen H, et al.
International Journal of Clinical and Experimental Pathology, 8(5), 5798-5798 (2015)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica