Pular para o conteúdo
Merck
Todas as fotos(3)

Key Documents

HPA010607

Sigma-Aldrich

Anti-AFP antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-α-1-Fetoprotein antibody produced in rabbit, Anti-α-Fetoglobulin antibody produced in rabbit, Anti-α-Fetoprotein precursor antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

recombinant expression
recombinant expression
RNAi knockdown
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR

nº de adesão UniProt

aplicação(ões)

research pathology

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... AFP(174)

Descrição geral

AFP (α fetoprotein) is a 70kDa serum glycoprotein, and is produced during gestation from fetal liver and yolk sac.

Imunogênio

α-Fetoprotein precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-AFP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

AFP (α fetoprotein) levels decrease by the second year of birth and its ectopic expression is linked with tumors, such as hepatobastoma, hepatocellular carcinoma (HCC) and yolk sac tumors. Maximum AFP-expressing tumors are of stomach, bile duct or pancreatic origin. AFP-expressing rectal cancer is extremely rare and is usually metastasized to liver with poor prognosis. In patients with chronic hepatitis C, high levels of this protein are linked with increased risk of developing HCC. In patients with metastatic gastric cancer (GC), follow-up of AFP concentrations can help determine early treatment response. For early and intermediate stages of HCC, the addition of this protein and ascites in the BCLC Barcelona Clinic Liver Cancer (BCLC) staging can improvise prognosis determination.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86803

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Xiaoxia Zhu et al.
Clinical laboratory, 60(11), 1795-1800 (2015-02-05)
Serum a-fetoprotein (AFP) is one of the most common diagnostic markers for hepatocellular cancer (HCC) in the laboratory. As other immunoassays, AFP determination is not free from interferences. Natural antibodies like rheumatoid factors (RFs) may induce falsely elevated results, leading
Angela D Pardee et al.
Journal of immunology (Baltimore, Md. : 1950), 193(11), 5723-5732 (2014-10-31)
Several tumor-derived factors have been implicated in dendritic cell (DC) dysfunction in cancer patients. α-fetoprotein (AFP) is an oncofetal Ag that is highly expressed in abnormalities of prenatal development and several epithelial cancers, including hepatocellular carcinoma (HCC). In HCC patients
Akira Shimamoto et al.
PloS one, 9(11), e112900-e112900 (2014-11-13)
Werner syndrome (WS) is a premature aging disorder characterized by chromosomal instability and cancer predisposition. Mutations in WRN are responsible for the disease and cause telomere dysfunction, resulting in accelerated aging. Recent studies have revealed that cells from WS patients
Ali Murat Tatli et al.
Asian Pacific journal of cancer prevention : APJCP, 16(5), 2003-2007 (2015-03-17)
Elevated serum alpha-fetoprotein (AFP) levels in adults are considered abnormal. This parameter is used mostly in the diagnosis and follow-up of hepatocellular carcinomas and yolk sac tumors. Among the other rare tumors accompanied with elevated serum AFP levels, gastric cancer
Koji Takayama et al.
World journal of gastroenterology, 21(15), 4696-4706 (2015-04-29)
To investigate the impact of telaprevir-based triple therapy on the serum alpha-fetoprotein (AFP) level of chronic hepatitis C patients. A total of 210 patients with chronic hepatitis C genotype 1 of high viral load (baseline serum hepatitis C virus RNA

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica