Pular para o conteúdo
Merck
Todas as fotos(2)

Key Documents

HPA008773

Sigma-Aldrich

Anti-CA12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-CA-XII antibody produced in rabbit, Anti-Carbonate dehydratase XII antibody produced in rabbit, Anti-Carbonic anhydrase 12 precursor antibody produced in rabbit, Anti-Carbonic anhydrase XII antibody produced in rabbit, Anti-Tumor antigen HOM-RCC-3.1.3 antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA008773
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

sequência de imunogênio

TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ

nº de adesão UniProt

O43570

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CA12(771)

Categorias relacionadas

Descrição geral

CA12 (carbonic anhydrase XII) gene is localized to human chromosome 15q22. This gene is predominantly expressed in adult pancreas, colon, kidney and prostate. It belongs to α CA gene family, and is composed of a leader sequence, an α CA domain, a transmembrane region and a short cytoplasmic domain.

Imunogênio

Carbonic anhydrase 12 precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-CA12 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

CA12 (carbonic anhydrase XII) catalyzes the hydration of CO2 generated by cells into bicarbonate and protons. Expression of this enzyme in oral squamous cell carcinoma (OSCC) is related to tumor progression and poor prognosis. The expression levels of this enzyme are also linked to the histological grade of cervical cancer, and absence of its expression correlates with poorly differentiated phenotype. The presence of this enzyme marginally links with better disease-free survival of cervical cancer patients.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71649

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Damien Ambrosetti et al.
PloS one, 13(2), e0193477-e0193477 (2018-02-27)
Clear-cell renal cell carcinoma (ccRCC) is the most common type of kidney cancer. Although ccRCC is characterized by common recurrent genetic abnormalities, including inactivation of the von Hippel-Lindau (vhl) tumor suppressor gene resulting in stabilization of hypoxia-inducible factors (HIFs), the
J V Stoyanov et al.
European cells & materials, 21, 533-547 (2011-06-29)
There is evidence that mesenchymal stem cells (MSCs) can differentiate towards an intervertebral disc (IVD)-like phenotype. We compared the standard chondrogenic protocol using transforming growth factor beta-1 (TGFß) to the effects of hypoxia, growth and differentiation factor-5 (GDF5), and coculture
Karen A Power et al.
Arthritis and rheumatism, 63(12), 3876-3886 (2011-12-01)
Back pain is a major cause of disability, affecting millions of people worldwide. One cause of axial back pain is degeneration of the nucleus pulposus (NP) of the intervertebral disc. This study was undertaken to investigate associations of NP cells
Mark C Lloyd et al.
Cancer research, 76(11), 3136-3144 (2016-03-25)
Spatial heterogeneity in tumors is generally thought to result from branching clonal evolution driven by random mutations that accumulate during tumor development. However, this concept rests on the implicit assumption that cancer cells never evolve to a fitness maximum because
Krissie Lenting et al.
Acta neuropathologica communications, 7(1), 185-185 (2019-11-22)
Many biology-based precision drugs are available that neutralize aberrant molecular pathways in cancer. Molecular heterogeneity and the lack of reliable companion diagnostic biomarkers for many drugs makes targeted treatment of cancer inaccurate for many individuals. Identifying actionable hyperactive biological pathways
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica