HPA008160

Anti-NGEF antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Eph-interacting exchange protein, Anti-Ephexin-1, Anti-Neuronal guanine nucleotide exchange factor
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA008160

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry: 1:50- 1:200
• sequência de imunogênio: METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST
• nº de adesão UniProt: Q8N5V2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NGEF(25791)

Descrição

Descrição geral

NGEF (neuronal guanine nucleotide exchange factor) gene encodes a member of the family of Dbl genes, the members of which function as guanine nucleotide exchange factors for the Rho-type GTPases. The encoded protein is abundantly expressed in brain, with the highest expression being in the caudate nucleus, a region linked to the control of movement. The gene is mapped to human chromosome 2q37 and the encoded protein contains a translated trinucleotide repeat, a polyglutamic acid stretch interspaced by a glycine.

Imunogênio

Ephexin-1 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

NGEF (neuronal guanine nucleotide exchange factor) gene encodes a protein that is also called as Ephexin. It is an Eph receptor-interacting protein that is modulated by binding to the receptor upon stimulation by Ephrin-A. Ephexin is a guanine nucleotide exchange factor that activates the GTPase RhoA and inhibits Cdc42 and Rac1. It also affects cell morphology. It forms a molecular link between Eph receptors and the actin cytoskeleton and regulates growth cone motility.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71480

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)